|
Visit www.epidirect.com |
|
Epidirect General Information |
| |
Epidirect is providing Windows web hosting services, has been founded in 1997 and now it's years in business.
epidirect.com average uptime is 99.996% (rank #463 on our directory) with total 84599 successful and 3 failed checks,
monitored since 2006-02-14. Similar companies with 99.996% uptime are and highway54.com.
Search for "epidirect.com" on 3 biggest search engines returns average of 563 results so company name popularity rank is #1164.
There have been 38 positive votes for Epidirect and 6 negative.
And overall company rank on our directory is #211 (similar companies are pick.net and excell.net)
|
|
Web Hosting Packages |
| |
Entry Level (Type: Windows) - 100 MB space, 2000 MB bandwidth for $5.6/mo
Bronze (Type: Windows) - 500 MB space, 5000 MB bandwidth for $14.95/mo
Silver (Type: Windows) - 1000 MB space, 10 GB bandwidth for $29.95/mo
Gold (Type: Windows) - 2000 MB space, 20 GB bandwidth for $99.95/mo
Platinum (Type: Windows) - 5000 MB space, 30 GB bandwidth for $199.95/mo
|
|
Some technical data about epidirect.com |
| |
IP Location: Sprint Canada Inc
Blacklist Status: Clear
Nameserver: NS1.EPIDIRECT.COM NS2.EPIDIRECT.COM
Website Title: EPI Internet Direct - Internet Web Site and Application Hosting Services
Description: EPI Internet Direct is a web hosting and application service provider supporting clients around the world with high quality, cost-effective professional hosting solutions.
Back to "E" directory |
|
|
|
|
|
|
www.Hosting24.com
#1 MOST RELIABLE, GLOBAL #1 RATING Unlimited Space, Unlimited Bandwidth, Unlimited Reseller Hosting Option, Free Domain for Life all for $4.84/mo
www.000webhost.com
Best Free Hosting provider, 250 MB Space, 100 GB Bandwidth - $0.00/mo, no advertising
www.IXWebHosting.com
Value for Money: 100 GB Space, 1000 GB Bandwidth, Host 2 Domains, Free domain registration, all Just for $7.95/mo
|
|
|
|
|
Web Hosting Reviews and Ratings |
|
| malu, 21st 2009 January, 2009 |
>gi|18425121|ref|NP_569040.1| MAPKKK5 (Mitogen-activated protein kinase kinase kinase 5); kinase [Arabidopsis thaliana]
MRWLPQISFSSPSSSPSSSLKPVASYSESPDPDRNQDRDRFHRRLFRFNRGRLTRQRKLRHLTDDDVLLGERRASTSSSTFDSGLTRSPSAFTAVPRSPSAVPLPLPLPLPEVAGIRNAANARGLDDRDRDPERLISDRTSSGPPLTSVNGGFARDSRKATENSSYQDFSPRNRNGYWVNIPTMSAPTSPYMSPVPSPQRKSTGHDLPFFYLPPKSNQAWSAPDMPLDTSGLPPPAFYDITAFSTDNSPIHSPQPRSPRKQIRSPQPSRPSSPLHSVDSSAPPRDSVSSPLHPRLSTDVTNGRRDCCNVHPLPLPPGATCSSSSAASVPSPQAPLKLDSFPMNSQWKKGKLIGRGTFGSVYVASNSETGALCAMKEVELFPDDPKSAECIKQLEQEIKLLSNLQHPNIVQYFGSETVEDRFFIYLEYVHPGSINKYIRDHCGTMTESVVRNFTRHILSGLAYLHNKKTVHRDIKGANLLVDASGVVKLADFGMAKHLTGQRADLSLKGSPYWMAPELMQAVMQKDSNPDLAFAVDIWSLGCTIIEMFTGKPPWSEFEGAAAMFKVMRDSPPIPESMSPEGKDFLRLCFQRNPAERPTASMLLEHRFLKNSLQPTSPSNSDVSQLFNGMNITEPSSRREKPNFKLDQVPRARNMTSSESESGQQQQQQQYRSPDLTGTVNRLSPRSTLEAIPSPCPSQRPKPSSSDRRRTGVTSDHL
|
|
|
|
|
|
|
|
|
|