Home Best Hosting Companies Cheap Hosting List Web Hosting news Coupons / Discounts Links
Visit www.epidirect.com
Epidirect General Information
  Epidirect is providing Windows web hosting services, has been founded in 1997 and now it's years in business.

epidirect.com average uptime is 99.996% (rank #463 on our directory) with total 84599 successful and 3 failed checks, monitored since 2006-02-14. Similar companies with 99.996% uptime are and highway54.com.

Search for "epidirect.com" on 3 biggest search engines returns average of 563 results so company name popularity rank is #1164.

There have been 38 positive votes for Epidirect and 6 negative. And overall company rank on our directory is #211 (similar companies are pick.net and excell.net)

Web Hosting Packages
  Entry Level (Type: Windows) - 100 MB space, 2000 MB bandwidth for $5.6/mo

Bronze (Type: Windows) - 500 MB space, 5000 MB bandwidth for $14.95/mo

Silver (Type: Windows) - 1000 MB space, 10 GB bandwidth for $29.95/mo

Gold (Type: Windows) - 2000 MB space, 20 GB bandwidth for $99.95/mo

Platinum (Type: Windows) - 5000 MB space, 30 GB bandwidth for $199.95/mo

Some technical data about epidirect.com
  IP Location: Sprint Canada Inc
Blacklist Status: Clear
Nameserver: NS1.EPIDIRECT.COM NS2.EPIDIRECT.COM
Website Title: EPI Internet Direct - Internet Web Site and Application Hosting Services
Description: EPI Internet Direct is a web hosting and application service provider supporting clients around the world with high quality, cost-effective professional hosting solutions.

Back to "E" directory


www.Hosting24.com
#1 MOST RELIABLE, GLOBAL #1 RATING Unlimited Space, Unlimited Bandwidth, Unlimited Reseller Hosting Option, Free Domain for Life all for $4.84/mo

www.000webhost.com
Best Free Hosting provider, 250 MB Space, 100 GB Bandwidth - $0.00/mo, no advertising

www.IXWebHosting.com
Value for Money: 100 GB Space, 1000 GB Bandwidth, Host 2 Domains, Free domain registration, all Just for $7.95/mo
Web Hosting Reviews and Ratings
malu, 21st 2009 January, 2009
>gi|18425121|ref|NP_569040.1| MAPKKK5 (Mitogen-activated protein kinase kinase kinase 5); kinase [Arabidopsis thaliana]
MRWLPQISFSSPSSSPSSSLKPVASYSESPDPDRNQDRDRFHRRLFRFNRGRLTRQRKLRHLTDDDVLLGERRASTSSSTFDSGLTRSPSAFTAVPRSPSAVPLPLPLPLPEVAGIRNAANARGLDDRDRDPERLISDRTSSGPPLTSVNGGFARDSRKATENSSYQDFSPRNRNGYWVNIPTMSAPTSPYMSPVPSPQRKSTGHDLPFFYLPPKSNQAWSAPDMPLDTSGLPPPAFYDITAFSTDNSPIHSPQPRSPRKQIRSPQPSRPSSPLHSVDSSAPPRDSVSSPLHPRLSTDVTNGRRDCCNVHPLPLPPGATCSSSSAASVPSPQAPLKLDSFPMNSQWKKGKLIGRGTFGSVYVASNSETGALCAMKEVELFPDDPKSAECIKQLEQEIKLLSNLQHPNIVQYFGSETVEDRFFIYLEYVHPGSINKYIRDHCGTMTESVVRNFTRHILSGLAYLHNKKTVHRDIKGANLLVDASGVVKLADFGMAKHLTGQRADLSLKGSPYWMAPELMQAVMQKDSNPDLAFAVDIWSLGCTIIEMFTGKPPWSEFEGAAAMFKVMRDSPPIPESMSPEGKDFLRLCFQRNPAERPTASMLLEHRFLKNSLQPTSPSNSDVSQLFNGMNITEPSSRREKPNFKLDQVPRARNMTSSESESGQQQQQQQYRSPDLTGTVNRLSPRSTLEAIPSPCPSQRPKPSSSDRRRTGVTSDHL
Write Your Review
Your name

Your epidirect.com review

Positive Negative


Hosting24.com #1
000WebHost #2
IXWebHosting #3
EasyCGI #4
iPower #5
ICDSoft #6
HostGator #7
HostOny #8
BlueHost #9
LunarPages #10
Hosting Type
Disk Space MB
Bandwidth GB
Price $/mo
Links
Cheap Web Hosting Reviews
Top Web Hosting
Web Hosting Reviews
Vistainter.com is web hosting reviews directory. © 2004 - 2010